Partial recombinant C3 protein enables focused research on specific domains for functional studies
N-terminal 6xHis tag allows easy purification and detection using immobilized ligands
High purity (>90%) as determined by SDS-PAGE ensures reliable experimental results
Available in multiple sizes to accommodate different experimental needs
Stable in storage with liquid form lasting 6 months and lyophilized form lasting 12 months at 20°C (80°C)
Summarized by Shop
Size: 200ug. Other sizes are also available. Please Inquire. In Stock: Yes Lead time: 3-7 working days Research Topic: Immunology Uniprot ID: P01024 Gene Names: C3 Organism: Homo sapiens (Human) AA Sequence: YSIITPNILRLESEETMVLEAHDAQGDVPVTVTVHDFPGKKLVLSSEKTVLTPATNHMGNVTFTIPANREFKSEKGRNKFVTVQATFGTQVVEKVVLVSLQSGYLFIQTDKTIYTPGSTVLYRIFTVNHKLLPVGRTVM
Size
200 ng (other sizes available upon request)
Expression region
26–225 aa (partial sequence)
Source
E. coli
Tag
N-terminal 6xHis
Molecular weight
26.4 kDa
Purity
>90% (SDS-PAGE)
Storage buffer
Tris-based buffer 50% glycerol
Shelf life
Liquid form 6 months at 20°C/80°C, lyophilized form 12 months at 20°C/80°C